Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143506.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
RALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQR WGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 12,677.945 | ||
Theoretical pI: | 9.647 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 58.142 | ||
aromaticity | 0.018 | ||
GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.286 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143506.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
GADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,677.945 | ||
Theoretical pI: | 9.647 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 58.142 | ||
aromaticity | 0.018 | ||
GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.286 | ||
sheet | 0.170 |