| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143509.1 | 3prime_partial | 126 | 2-379(+) |
Amino Acid sequence : | |||
| MKNPSVKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPNDYPFKPPSFMLLTPNGRFETQTKICLSISNYHPEHWQPSWSVRTALVALIAFMPTNPGG ALGSLD | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,395.240 | ||
| Theoretical pI: | 5.567 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 42.508 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.302 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143509.1 | 3prime_partial | 126 | 2-379(+) |
Amino Acid sequence : | |||
| MKNPSVKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPNDYPFKPPSFMLLTPNGRFETQTKICLSISNYHPEHWQPSWSVRTALVALIAFMPTNPGG ALGSLD | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,395.240 | ||
| Theoretical pI: | 5.567 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 42.508 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.302 | ||
| sheet | 0.238 | ||