Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143515.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
AVKLAPSAASELLGNGRISMRKTAKPKQVSSGSPWYGADRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG AQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGA | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,665.845 | ||
Theoretical pI: | 6.964 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
Instability index: | 24.922 | ||
aromaticity | 0.109 | ||
GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.288 | ||
sheet | 0.301 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143515.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
AVKLAPSAASELLGNGRISMRKTAKPKQVSSGSPWYGADRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG AQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGA | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,665.845 | ||
Theoretical pI: | 6.964 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
Instability index: | 24.922 | ||
aromaticity | 0.109 | ||
GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.288 | ||
sheet | 0.301 |