| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143515.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
| AVKLAPSAASELLGNGRISMRKTAKPKQVSSGSPWYGADRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG AQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGA | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,665.845 | ||
| Theoretical pI: | 6.964 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 24.922 | ||
| aromaticity | 0.109 | ||
| GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.288 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143515.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
| AVKLAPSAASELLGNGRISMRKTAKPKQVSSGSPWYGADRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG AQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGA | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,665.845 | ||
| Theoretical pI: | 6.964 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 24.922 | ||
| aromaticity | 0.109 | ||
| GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.288 | ||
| sheet | 0.301 | ||