| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143535.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| TSESENMNWILANSKPCPKCKRPIEKNHGCMHMTCSLPCKFEFCWLCLGAWSEHGDRTGGYYACNRYEIAKQEGVYGEAEKRREMAKNSLERYTHYYERWASNQVSRQKAFADLESMQTE KLDKLSEKQSQPESQLKFVIEAWEQIVECRRVLKWTYAYGYYLPEDEHAKKVFFEYLQGEA | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 21,431.007 | ||
| Theoretical pI: | 6.506 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51380 | ||
| Instability index: | 64.156 | ||
| aromaticity | 0.133 | ||
| GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.188 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143535.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| TSESENMNWILANSKPCPKCKRPIEKNHGCMHMTCSLPCKFEFCWLCLGAWSEHGDRTGGYYACNRYEIAKQEGVYGEAEKRREMAKNSLERYTHYYERWASNQVSRQKAFADLESMQTE KLDKLSEKQSQPESQLKFVIEAWEQIVECRRVLKWTYAYGYYLPEDEHAKKVFFEYLQGEA | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 21,431.007 | ||
| Theoretical pI: | 6.506 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51380 | ||
| Instability index: | 64.156 | ||
| aromaticity | 0.133 | ||
| GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.188 | ||
| sheet | 0.293 | ||