Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143535.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
TSESENMNWILANSKPCPKCKRPIEKNHGCMHMTCSLPCKFEFCWLCLGAWSEHGDRTGGYYACNRYEIAKQEGVYGEAEKRREMAKNSLERYTHYYERWASNQVSRQKAFADLESMQTE KLDKLSEKQSQPESQLKFVIEAWEQIVECRRVLKWTYAYGYYLPEDEHAKKVFFEYLQGEA | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 21,431.007 | ||
Theoretical pI: | 6.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51380 | ||
Instability index: | 64.156 | ||
aromaticity | 0.133 | ||
GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.188 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143535.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
TSESENMNWILANSKPCPKCKRPIEKNHGCMHMTCSLPCKFEFCWLCLGAWSEHGDRTGGYYACNRYEIAKQEGVYGEAEKRREMAKNSLERYTHYYERWASNQVSRQKAFADLESMQTE KLDKLSEKQSQPESQLKFVIEAWEQIVECRRVLKWTYAYGYYLPEDEHAKKVFFEYLQGEA | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 21,431.007 | ||
Theoretical pI: | 6.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51380 | ||
Instability index: | 64.156 | ||
aromaticity | 0.133 | ||
GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.188 | ||
sheet | 0.293 |