| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143537.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCE | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 19,799.348 | ||
| Theoretical pI: | 5.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 44.377 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.282 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143537.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCE | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 19,799.348 | ||
| Theoretical pI: | 5.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 44.377 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.282 | ||
| sheet | 0.254 | ||