| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143539.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| IYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYRGTIDQRWGQFEKAISRMQVDVH AKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,376.742 | ||
| Theoretical pI: | 11.462 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.170 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.185 | ||
| turn | 0.287 | ||
| sheet | 0.139 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143539.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| DLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRLSRHDRPEVGPV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,376.742 | ||
| Theoretical pI: | 11.462 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.170 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.185 | ||
| turn | 0.287 | ||
| sheet | 0.139 | ||