Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143539.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
IYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYRGTIDQRWGQFEKAISRMQVDVH AKN* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 12,376.742 | ||
Theoretical pI: | 11.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.170 | ||
aromaticity | 0.019 | ||
GRAVY | -1.299 | ||
Secondary Structure Fraction | |||
Helix | 0.185 | ||
turn | 0.287 | ||
sheet | 0.139 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143539.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
DLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRLSRHDRPEVGPV* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,376.742 | ||
Theoretical pI: | 11.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.170 | ||
aromaticity | 0.019 | ||
GRAVY | -1.299 | ||
Secondary Structure Fraction | |||
Helix | 0.185 | ||
turn | 0.287 | ||
sheet | 0.139 |