Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143551.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
YLNAGGTVWTDGCPPIQSLANIGEMRFSIAMSSQNNNSVDSTKLNKTSSDILNRMTSTINEMQFPTVSNAAFGVSLLQGEENIGQFLYVEGIEYRMWNTYDVHFYSSFSLVSLFPKLELS IQRDFAVGVMIND | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,838.527 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 41.368 | ||
aromaticity | 0.113 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.308 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143551.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
YLNAGGTVWTDGCPPIQSLANIGEMRFSIAMSSQNNNSVDSTKLNKTSSDILNRMTSTINEMQFPTVSNAAFGVSLLQGEENIGQFLYVEGIEYRMWNTYDVHFYSSFSLVSLFPKLELS IQRDFAVGVMIND | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,838.527 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 41.368 | ||
aromaticity | 0.113 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.308 | ||
sheet | 0.226 |