| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143551.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
| YLNAGGTVWTDGCPPIQSLANIGEMRFSIAMSSQNNNSVDSTKLNKTSSDILNRMTSTINEMQFPTVSNAAFGVSLLQGEENIGQFLYVEGIEYRMWNTYDVHFYSSFSLVSLFPKLELS IQRDFAVGVMIND | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,838.527 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 41.368 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.308 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143551.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
| YLNAGGTVWTDGCPPIQSLANIGEMRFSIAMSSQNNNSVDSTKLNKTSSDILNRMTSTINEMQFPTVSNAAFGVSLLQGEENIGQFLYVEGIEYRMWNTYDVHFYSSFSLVSLFPKLELS IQRDFAVGVMIND | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,838.527 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 41.368 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.308 | ||
| sheet | 0.226 | ||