Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143552.1 | internal | 159 | 478-2(-) |
Amino Acid sequence : | |||
IRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLLPLHAMVVVV VTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPI | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 13,219.751 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 74.558 | ||
aromaticity | 0.142 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.392 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143552.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
DRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLRLERR ASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHAD | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 13,219.751 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 74.558 | ||
aromaticity | 0.142 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.392 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143552.1 | 5prime_partial | 120 | 477-115(-) |
Amino Acid sequence : | |||
SACSFSTTTVSTPHSHLAVMAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,219.751 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 74.558 | ||
aromaticity | 0.142 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.392 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143552.1 | internal | 159 | 478-2(-) |
Amino Acid sequence : | |||
IRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLLPLHAMVVVV VTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPI | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 13,219.751 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 74.558 | ||
aromaticity | 0.142 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.392 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143552.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
DRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLRLERR ASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHAD | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 13,219.751 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 74.558 | ||
aromaticity | 0.142 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.392 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143552.1 | 5prime_partial | 120 | 477-115(-) |
Amino Acid sequence : | |||
SACSFSTTTVSTPHSHLAVMAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,219.751 | ||
Theoretical pI: | 10.519 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 74.558 | ||
aromaticity | 0.142 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.392 | ||
sheet | 0.192 |