| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143552.1 | internal | 159 | 478-2(-) |
Amino Acid sequence : | |||
| IRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLLPLHAMVVVV VTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 13,219.751 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 74.558 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.392 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143552.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| DRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLRLERR ASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHAD | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 13,219.751 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 74.558 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.392 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143552.1 | 5prime_partial | 120 | 477-115(-) |
Amino Acid sequence : | |||
| SACSFSTTTVSTPHSHLAVMAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,219.751 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 74.558 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.392 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143552.1 | internal | 159 | 478-2(-) |
Amino Acid sequence : | |||
| IRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLLPLHAMVVVV VTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 13,219.751 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 74.558 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.392 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143552.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| DRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLRLERR ASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHAD | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 13,219.751 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 74.558 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.392 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143552.1 | 5prime_partial | 120 | 477-115(-) |
Amino Acid sequence : | |||
| SACSFSTTTVSTPHSHLAVMAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,219.751 | ||
| Theoretical pI: | 10.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 74.558 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.392 | ||
| sheet | 0.192 | ||