| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143553.1 | internal | 196 | 1-588(+) |
Amino Acid sequence : | |||
| ARAAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCA AFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLV | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 20,734.410 | ||
| Theoretical pI: | 6.064 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 24.973 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.245 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143553.1 | internal | 196 | 1-588(+) |
Amino Acid sequence : | |||
| ARAAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCA AFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLV | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 20,734.410 | ||
| Theoretical pI: | 6.064 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 24.973 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.245 | ||
| sheet | 0.260 | ||