| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143554.1 | 3prime_partial | 154 | 38-499(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVN | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,247.554 | ||
| Theoretical pI: | 6.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 31.166 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.260 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143554.1 | 3prime_partial | 154 | 38-499(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVN | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,247.554 | ||
| Theoretical pI: | 6.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 31.166 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.260 | ||
| sheet | 0.240 | ||