Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143554.1 | 3prime_partial | 154 | 38-499(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVN | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,247.554 | ||
Theoretical pI: | 6.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 31.166 | ||
aromaticity | 0.045 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.260 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143554.1 | 3prime_partial | 154 | 38-499(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVN | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,247.554 | ||
Theoretical pI: | 6.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 31.166 | ||
aromaticity | 0.045 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.260 | ||
sheet | 0.240 |