| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143582.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| ARVSECGVSGPIPSFISTWTSLEELVISRCKLTGSIPPSLGNLVNLTNTGFVGNKLTGTIPASLFSKVNNGSRPSFEVNHNMLTGPIPRSFASIDTLDIDVSYNQLCGPIPTGGVFASIN LVFVDHNKCLCGPPLAACK* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,972.562 | ||
| Theoretical pI: | 9.807 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.764 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.207 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143582.1 | internal | 140 | 420-1(-) |
Amino Acid sequence : | |||
| SLACRQWWSTKAFIVVDEHQIDRRKDPSGRYRPTQLIVAHVNVQRVDAGKRPRNRSSQHIVVHFERRSRAIVDFAEEGRGYGPGELVSNEAGVGEVNKVAKRRRDGARELAAADYEFFEG SPRGDERRDRARDAALRDSC | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,972.562 | ||
| Theoretical pI: | 9.807 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.764 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.207 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143582.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| ARVSECGVSGPIPSFISTWTSLEELVISRCKLTGSIPPSLGNLVNLTNTGFVGNKLTGTIPASLFSKVNNGSRPSFEVNHNMLTGPIPRSFASIDTLDIDVSYNQLCGPIPTGGVFASIN LVFVDHNKCLCGPPLAACK* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,972.562 | ||
| Theoretical pI: | 9.807 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.764 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.207 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143582.1 | internal | 140 | 420-1(-) |
Amino Acid sequence : | |||
| SLACRQWWSTKAFIVVDEHQIDRRKDPSGRYRPTQLIVAHVNVQRVDAGKRPRNRSSQHIVVHFERRSRAIVDFAEEGRGYGPGELVSNEAGVGEVNKVAKRRRDGARELAAADYEFFEG SPRGDERRDRARDAALRDSC | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,972.562 | ||
| Theoretical pI: | 9.807 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 50.764 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.207 | ||
| sheet | 0.221 | ||