Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143583.1 | internal | 188 | 3-566(+) |
Amino Acid sequence : | |||
ELVSLQSGTTKKDGEVVDAGKEREKKNKEADVLEDKGKEVSSKDRDVGSSSRGKVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKREYDLDDTQM GVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNS | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 21,418.121 | ||
Theoretical pI: | 5.349 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 31.318 | ||
aromaticity | 0.064 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.223 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143583.1 | internal | 188 | 3-566(+) |
Amino Acid sequence : | |||
ELVSLQSGTTKKDGEVVDAGKEREKKNKEADVLEDKGKEVSSKDRDVGSSSRGKVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKREYDLDDTQM GVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNS | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 21,418.121 | ||
Theoretical pI: | 5.349 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 31.318 | ||
aromaticity | 0.064 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.223 | ||
sheet | 0.245 |