| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143583.1 | internal | 188 | 3-566(+) |
Amino Acid sequence : | |||
| ELVSLQSGTTKKDGEVVDAGKEREKKNKEADVLEDKGKEVSSKDRDVGSSSRGKVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKREYDLDDTQM GVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNS | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,418.121 | ||
| Theoretical pI: | 5.349 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 31.318 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.223 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143583.1 | internal | 188 | 3-566(+) |
Amino Acid sequence : | |||
| ELVSLQSGTTKKDGEVVDAGKEREKKNKEADVLEDKGKEVSSKDRDVGSSSRGKVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVKREYDLDDTQM GVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNS | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,418.121 | ||
| Theoretical pI: | 5.349 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 31.318 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.223 | ||
| sheet | 0.245 | ||