| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143587.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
| ATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,041.662 | ||
| Theoretical pI: | 4.876 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 31.337 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.220 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143587.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
| ATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,041.662 | ||
| Theoretical pI: | 4.876 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 31.337 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.220 | ||
| sheet | 0.212 | ||