| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143590.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
| WTSLEELVISRCKLTGSIPPSLGNLVNLTNTGFVGNKLTGTIPASLFSKVNNGSRPSFEVNHNMLTGPIPRSFASIDTLDIDVSYNQLCGPIPTGGVFASINLVFVDHNKCLCGPPLAAC K* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,802.613 | ||
| Theoretical pI: | 7.824 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 25.517 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.364 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143590.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
| WTSLEELVISRCKLTGSIPPSLGNLVNLTNTGFVGNKLTGTIPASLFSKVNNGSRPSFEVNHNMLTGPIPRSFASIDTLDIDVSYNQLCGPIPTGGVFASINLVFVDHNKCLCGPPLAAC K* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,802.613 | ||
| Theoretical pI: | 7.824 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 25.517 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.364 | ||
| sheet | 0.190 | ||