Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143595.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKV | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,480.258 | ||
Theoretical pI: | 10.005 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 35.750 | ||
aromaticity | 0.116 | ||
GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.277 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143595.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKV | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,480.258 | ||
Theoretical pI: | 10.005 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 35.750 | ||
aromaticity | 0.116 | ||
GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.277 | ||
sheet | 0.214 |