| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143595.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
| ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKV | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,480.258 | ||
| Theoretical pI: | 10.005 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 35.750 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.277 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143595.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
| ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKV | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,480.258 | ||
| Theoretical pI: | 10.005 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 35.750 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.277 | ||
| sheet | 0.214 | ||