Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143602.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
LACAFRVSVATMHVVGSSLGWEYPPNVTFYQDWAAKKTFFVGDKLGVPLQVVDVQPHRGVKGGLSEMHPKQGDQRVHPGACRHQSDRTRWPILLLHRRPQLRAQHEAVHHGPPIHGCSAA SWSNLIGHNYH* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 10,790.559 | ||
Theoretical pI: | 9.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 59.485 | ||
aromaticity | 0.101 | ||
GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.333 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143602.1 | 3prime_partial | 128 | 386-3(-) |
Amino Acid sequence : | |||
MTDQIAPAGGRAAVDGRTVMDSFMLCSQLRPTVQKKYRPPGAVRLMTTGPWMNSLITLFWVHFGKSSFDTSMRLYIDDLKGNTELIPHEKGFLGSPILIEGDIRRVFPAQAASYNMHCRD RYPKGASQ | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 10,790.559 | ||
Theoretical pI: | 9.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 59.485 | ||
aromaticity | 0.101 | ||
GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.333 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143602.1 | complete | 99 | 79-378(+) |
Amino Acid sequence : | |||
MSPSIKIGLPRKPFSWGISSVFPFRSSMYNLIEVSKEDFPKCTQNKVINEFIQGPVVINLTAPGGRYFFCTVGLNCEHSMKLSITVLPSTAALPPAGAI* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,790.559 | ||
Theoretical pI: | 9.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 59.485 | ||
aromaticity | 0.101 | ||
GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.333 | ||
sheet | 0.192 |