| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143602.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
| LACAFRVSVATMHVVGSSLGWEYPPNVTFYQDWAAKKTFFVGDKLGVPLQVVDVQPHRGVKGGLSEMHPKQGDQRVHPGACRHQSDRTRWPILLLHRRPQLRAQHEAVHHGPPIHGCSAA SWSNLIGHNYH* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 10,790.559 | ||
| Theoretical pI: | 9.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 59.485 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.333 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143602.1 | 3prime_partial | 128 | 386-3(-) |
Amino Acid sequence : | |||
| MTDQIAPAGGRAAVDGRTVMDSFMLCSQLRPTVQKKYRPPGAVRLMTTGPWMNSLITLFWVHFGKSSFDTSMRLYIDDLKGNTELIPHEKGFLGSPILIEGDIRRVFPAQAASYNMHCRD RYPKGASQ | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 10,790.559 | ||
| Theoretical pI: | 9.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 59.485 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.333 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143602.1 | complete | 99 | 79-378(+) |
Amino Acid sequence : | |||
| MSPSIKIGLPRKPFSWGISSVFPFRSSMYNLIEVSKEDFPKCTQNKVINEFIQGPVVINLTAPGGRYFFCTVGLNCEHSMKLSITVLPSTAALPPAGAI* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,790.559 | ||
| Theoretical pI: | 9.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 59.485 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.333 | ||
| sheet | 0.192 | ||