| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143605.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| SAPNLPYTSSQTLEGIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRL SRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,889.219 | ||
| Theoretical pI: | 8.317 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 55.394 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.262 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143605.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| SAPNLPYTSSQTLEGIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRL SRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,889.219 | ||
| Theoretical pI: | 8.317 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 55.394 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.262 | ||
| sheet | 0.220 | ||