Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143605.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
SAPNLPYTSSQTLEGIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRL SRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKI | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,889.219 | ||
Theoretical pI: | 8.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 55.394 | ||
aromaticity | 0.065 | ||
GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.262 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143605.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
SAPNLPYTSSQTLEGIKSGAKKIRRTFVLSASNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRL SRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKI | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,889.219 | ||
Theoretical pI: | 8.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 55.394 | ||
aromaticity | 0.065 | ||
GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.262 | ||
sheet | 0.220 |