Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143608.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
IVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDI NMDESPGIAIHRKYALHL | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,805.117 | ||
Theoretical pI: | 5.936 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 35.502 | ||
aromaticity | 0.101 | ||
GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.239 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143608.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
IVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDI NMDESPGIAIHRKYALHL | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,805.117 | ||
Theoretical pI: | 5.936 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 35.502 | ||
aromaticity | 0.101 | ||
GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.239 | ||
sheet | 0.268 |