| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143608.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| IVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDI NMDESPGIAIHRKYALHL | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,805.117 | ||
| Theoretical pI: | 5.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 35.502 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.239 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143608.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| IVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDI NMDESPGIAIHRKYALHL | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,805.117 | ||
| Theoretical pI: | 5.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 35.502 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.239 | ||
| sheet | 0.268 | ||