| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143623.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| ANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLFFVYSLDYARTRLANDAKASKGGGERQFNGLVDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGL YDSIKPVILTGKLQDSFLASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQILKNEGAKSLF | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,646.590 | ||
| Theoretical pI: | 9.841 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 14.218 | ||
| aromaticity | 0.159 | ||
| GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.251 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143623.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| ANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLFFVYSLDYARTRLANDAKASKGGGERQFNGLVDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGL YDSIKPVILTGKLQDSFLASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQILKNEGAKSLF | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,646.590 | ||
| Theoretical pI: | 9.841 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 14.218 | ||
| aromaticity | 0.159 | ||
| GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.251 | ||
| sheet | 0.226 | ||