| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143624.1 | 5prime_partial | 186 | 3-563(+) |
Amino Acid sequence : | |||
| ACGLQPIVDDEKAQSALDKIYRFNVLKFKDGKRGAVNGMKPDGTLDASMLQASEVWPGVTYALAATMIQEGMVETAFKTAQGVYEAAWSRNGLGYSFQVPEACNGNDQYRALNYMRPLSI WAMQWALSPPKLHKEEQRADDRGNSSLHNMEFSKIAEMLKLPEENTSRTSLGILYDIIREKFFPRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,873.530 | ||
| Theoretical pI: | 6.203 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
| Instability index: | 30.142 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.231 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143624.1 | 5prime_partial | 186 | 3-563(+) |
Amino Acid sequence : | |||
| ACGLQPIVDDEKAQSALDKIYRFNVLKFKDGKRGAVNGMKPDGTLDASMLQASEVWPGVTYALAATMIQEGMVETAFKTAQGVYEAAWSRNGLGYSFQVPEACNGNDQYRALNYMRPLSI WAMQWALSPPKLHKEEQRADDRGNSSLHNMEFSKIAEMLKLPEENTSRTSLGILYDIIREKFFPRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,873.530 | ||
| Theoretical pI: | 6.203 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
| Instability index: | 30.142 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.231 | ||
| sheet | 0.306 | ||