| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143628.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| GKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAA RVMIPARCRGSIISMSSIAS | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 14,666.664 | ||
| Theoretical pI: | 7.065 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 31.344 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.264 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143628.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| GKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAA RVMIPARCRGSIISMSSIAS | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 14,666.664 | ||
| Theoretical pI: | 7.065 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 31.344 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.264 | ||
| sheet | 0.229 | ||