| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143631.1 | internal | 176 | 3-530(+) |
Amino Acid sequence : | |||
| ENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPP LGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMK | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,034.489 | ||
| Theoretical pI: | 7.188 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 54.682 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.278 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143631.1 | internal | 176 | 3-530(+) |
Amino Acid sequence : | |||
| ENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPP LGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMK | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,034.489 | ||
| Theoretical pI: | 7.188 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 54.682 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.278 | ||
| sheet | 0.284 | ||