| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143644.1 | internal | 114 | 3-344(+) |
Amino Acid sequence : | |||
| TSGTFSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDH | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 13,080.914 | ||
| Theoretical pI: | 5.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 31.402 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.228 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143644.1 | internal | 114 | 3-344(+) |
Amino Acid sequence : | |||
| TSGTFSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDH | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 13,080.914 | ||
| Theoretical pI: | 5.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 31.402 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.228 | ||
| sheet | 0.263 | ||