| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143653.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
| VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLVLRLVL LRLLHHLLDVFLAQPALVVGDGNLVLLPRGLLV | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,102.928 | ||
| Theoretical pI: | 4.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 45.963 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143653.1 | internal | 153 | 2-460(+) |
Amino Acid sequence : | |||
| HEKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKM YQGAGADMGAGMDEDGPAPTGGSSAGPKIEEVD | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,102.928 | ||
| Theoretical pI: | 4.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 45.963 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143653.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
| VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLVLRLVL LRLLHHLLDVFLAQPALVVGDGNLVLLPRGLLV | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,102.928 | ||
| Theoretical pI: | 4.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 45.963 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143653.1 | internal | 153 | 2-460(+) |
Amino Acid sequence : | |||
| HEKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKM YQGAGADMGAGMDEDGPAPTGGSSAGPKIEEVD | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,102.928 | ||
| Theoretical pI: | 4.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 45.963 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||