| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143657.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
| QGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQG ACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,828.987 | ||
| Theoretical pI: | 8.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.619 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.291 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143657.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
| KVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKE LAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,828.987 | ||
| Theoretical pI: | 8.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.619 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.291 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143657.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
| QGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQG ACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,828.987 | ||
| Theoretical pI: | 8.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.619 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.291 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143657.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
| KVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKE LAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,828.987 | ||
| Theoretical pI: | 8.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.619 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.291 | ||
| sheet | 0.328 | ||