| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143659.1 | internal | 118 | 3-356(+) |
Amino Acid sequence : | |||
| TRLLHVYFLLGQGITQENANFLMTSPTLLSSPATILRLWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFSSNQFAPNLVAACLNSSQMIEVMYS | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,361.872 | ||
| Theoretical pI: | 4.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 52.869 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.263 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143659.1 | internal | 118 | 3-356(+) |
Amino Acid sequence : | |||
| TRLLHVYFLLGQGITQENANFLMTSPTLLSSPATILRLWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFSSNQFAPNLVAACLNSSQMIEVMYS | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,361.872 | ||
| Theoretical pI: | 4.426 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 52.869 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.263 | ||
| sheet | 0.322 | ||