| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143673.1 | internal | 130 | 3-392(+) |
Amino Acid sequence : | |||
| AEFDRLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQ GQVSVSPCSH | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,610.545 | ||
| Theoretical pI: | 7.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 40.385 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.208 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143673.1 | internal | 130 | 3-392(+) |
Amino Acid sequence : | |||
| AEFDRLPRLLSAALKSRKDQIIKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQ GQVSVSPCSH | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,610.545 | ||
| Theoretical pI: | 7.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 40.385 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.208 | ||
| sheet | 0.238 | ||