| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143675.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
| HEEEWGFFQLVNHGIPKELLDRVKKVCSECYKLDRERKFKESEPVQLLNELVGSGETGGRVDDVDWEDVFVLQDNNEWPANPPEFKKTMKEYREELKKLAEKVMEVMEENLGLAKGHMKH SFSGTDAPFFGTKVSHYPPCPH | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,369.024 | ||
| Theoretical pI: | 6.237 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.030 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.444 | ||
| turn | 0.148 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143675.1 | internal | 142 | 427-2(-) |
Amino Acid sequence : | |||
| VRAGGVVADFRAEERRVRAGERMLHVPLCETEVLFHHFHYLLRELLQFFSVLLHGFFELRWICRPLVVILQYKHIFPVHVIDPTTGLAATDQLVQQLNGLGLLELSLPIQLVALRANFLN AVEELFRNPVVHQLEESPLFLV | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,369.024 | ||
| Theoretical pI: | 6.237 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.030 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.444 | ||
| turn | 0.148 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143675.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
| HEEEWGFFQLVNHGIPKELLDRVKKVCSECYKLDRERKFKESEPVQLLNELVGSGETGGRVDDVDWEDVFVLQDNNEWPANPPEFKKTMKEYREELKKLAEKVMEVMEENLGLAKGHMKH SFSGTDAPFFGTKVSHYPPCPH | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,369.024 | ||
| Theoretical pI: | 6.237 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.030 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.444 | ||
| turn | 0.148 | ||
| sheet | 0.345 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143675.1 | internal | 142 | 427-2(-) |
Amino Acid sequence : | |||
| VRAGGVVADFRAEERRVRAGERMLHVPLCETEVLFHHFHYLLRELLQFFSVLLHGFFELRWICRPLVVILQYKHIFPVHVIDPTTGLAATDQLVQQLNGLGLLELSLPIQLVALRANFLN AVEELFRNPVVHQLEESPLFLV | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,369.024 | ||
| Theoretical pI: | 6.237 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.030 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.444 | ||
| turn | 0.148 | ||
| sheet | 0.345 | ||