| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143680.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| HEGKFVTEILAMALAFRLLSRSKQFYASQVILQQGHGVFVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERITIDPEDPAAVRQYANIMKMIREKAGLMTENEKVEYTVT HITKDIPDARTYLLKLKEIRIKSGIEDTIGGEAMMMEAL | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 11,213.350 | ||
| Theoretical pI: | 10.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 41.224 | ||
| aromaticity | 0.126 | ||
| GRAVY | 1.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.320 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143680.1 | 5prime_partial | 103 | 480-169(-) |
Amino Acid sequence : | |||
| SNASIIIASPPMVSSMPLLIRISLSFNKYVLASGMSFVICVTVYSTFSFSVIRPAFSLIIFMMLAYCLTAAGSSGSMVILSFRSIPRITSNFCFTSKKISFNI* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,213.350 | ||
| Theoretical pI: | 10.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 41.224 | ||
| aromaticity | 0.126 | ||
| GRAVY | 1.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.320 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143680.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| HEGKFVTEILAMALAFRLLSRSKQFYASQVILQQGHGVFVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERITIDPEDPAAVRQYANIMKMIREKAGLMTENEKVEYTVT HITKDIPDARTYLLKLKEIRIKSGIEDTIGGEAMMMEAL | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 11,213.350 | ||
| Theoretical pI: | 10.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 41.224 | ||
| aromaticity | 0.126 | ||
| GRAVY | 1.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.320 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143680.1 | 5prime_partial | 103 | 480-169(-) |
Amino Acid sequence : | |||
| SNASIIIASPPMVSSMPLLIRISLSFNKYVLASGMSFVICVTVYSTFSFSVIRPAFSLIIFMMLAYCLTAAGSSGSMVILSFRSIPRITSNFCFTSKKISFNI* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,213.350 | ||
| Theoretical pI: | 10.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 41.224 | ||
| aromaticity | 0.126 | ||
| GRAVY | 1.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.320 | ||
| sheet | 0.204 | ||