| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143705.1 | internal | 155 | 1-465(+) |
Amino Acid sequence : | |||
| TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,346.694 | ||
| Theoretical pI: | 6.675 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 28.850 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.168 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143705.1 | internal | 155 | 1-465(+) |
Amino Acid sequence : | |||
| TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,346.694 | ||
| Theoretical pI: | 6.675 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 28.850 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.168 | ||
| sheet | 0.239 | ||