| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143716.1 | internal | 130 | 3-392(+) |
Amino Acid sequence : | |||
| HPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPLANLLYSFNWELPAGIFKDDINMDESPGI AIHRKYALHL | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,875.978 | ||
| Theoretical pI: | 5.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 40.007 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143716.1 | internal | 130 | 3-392(+) |
Amino Acid sequence : | |||
| HPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPLANLLYSFNWELPAGIFKDDINMDESPGI AIHRKYALHL | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,875.978 | ||
| Theoretical pI: | 5.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 40.007 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||