Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143717.1 | internal | 144 | 3-434(+) |
Amino Acid sequence : | |||
LISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGNDGWRPDTVT VRKLNSRNSRSTMFKFDSVLPNNI | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 13,394.514 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 33.430 | ||
aromaticity | 0.089 | ||
GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.419 | ||
turn | 0.210 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143717.1 | 5prime_partial | 124 | 434-60(-) |
Amino Acid sequence : | |||
YVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLHRVEALPYDLLIILGL WNNG* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,394.514 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 33.430 | ||
aromaticity | 0.089 | ||
GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.419 | ||
turn | 0.210 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143717.1 | internal | 144 | 3-434(+) |
Amino Acid sequence : | |||
LISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGNDGWRPDTVT VRKLNSRNSRSTMFKFDSVLPNNI | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 13,394.514 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 33.430 | ||
aromaticity | 0.089 | ||
GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.419 | ||
turn | 0.210 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143717.1 | 5prime_partial | 124 | 434-60(-) |
Amino Acid sequence : | |||
YVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLHRVEALPYDLLIILGL WNNG* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,394.514 | ||
Theoretical pI: | 9.170 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 33.430 | ||
aromaticity | 0.089 | ||
GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.419 | ||
turn | 0.210 | ||
sheet | 0.298 |