| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143717.1 | internal | 144 | 3-434(+) |
Amino Acid sequence : | |||
| LISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGNDGWRPDTVT VRKLNSRNSRSTMFKFDSVLPNNI | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 13,394.514 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.430 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.210 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143717.1 | 5prime_partial | 124 | 434-60(-) |
Amino Acid sequence : | |||
| YVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLHRVEALPYDLLIILGL WNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,394.514 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.430 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.210 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143717.1 | internal | 144 | 3-434(+) |
Amino Acid sequence : | |||
| LISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCGTADSICYLYLGRYGNDGWRPDTVT VRKLNSRNSRSTMFKFDSVLPNNI | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 13,394.514 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.430 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.210 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143717.1 | 5prime_partial | 124 | 434-60(-) |
Amino Acid sequence : | |||
| YVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVVVGFLWRQAASVYLHRVEALPYDLLIILGL WNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,394.514 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 33.430 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.210 | ||
| sheet | 0.298 | ||