| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143730.1 | internal | 197 | 3-593(+) |
Amino Acid sequence : | |||
| TSDNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPR MAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPF | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,120.951 | ||
| Theoretical pI: | 8.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 53.709 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.320 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143730.1 | internal | 197 | 3-593(+) |
Amino Acid sequence : | |||
| TSDNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRSLLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPR MAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPF | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,120.951 | ||
| Theoretical pI: | 8.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 53.709 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.126 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.320 | ||
| sheet | 0.254 | ||