| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143731.1 | internal | 212 | 2-637(+) |
Amino Acid sequence : | |||
| TTTSKVLLTGQDCDHKRRLNEGSPRDIMAEVSKTHEAIQSLDKTVSTLEMELAVARTNRIDHPDSNGESGKGLQKAFVVIGINTAFSSKKRRESLRETWVPRGPKLKRLEEEKGIVIRFV IGHSATPGGVLDRAIDAENAESKDFLRLEHVEGYHELSMKTKLYFSTALSIWDAHFYVKVDDDVHVNLGMLTTTLARHKTEPRIYIGCMKSG | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,773.809 | ||
| Theoretical pI: | 8.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 33.944 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.203 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143731.1 | internal | 212 | 2-637(+) |
Amino Acid sequence : | |||
| TTTSKVLLTGQDCDHKRRLNEGSPRDIMAEVSKTHEAIQSLDKTVSTLEMELAVARTNRIDHPDSNGESGKGLQKAFVVIGINTAFSSKKRRESLRETWVPRGPKLKRLEEEKGIVIRFV IGHSATPGGVLDRAIDAENAESKDFLRLEHVEGYHELSMKTKLYFSTALSIWDAHFYVKVDDDVHVNLGMLTTTLARHKTEPRIYIGCMKSG | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,773.809 | ||
| Theoretical pI: | 8.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 33.944 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.203 | ||
| sheet | 0.255 | ||