Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143732.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
VNQNLERAVKENDRVYLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVE AVQISGGPSGLEAEIQQLRDLRRVNQELLVQTEELLQKEAGEDAQFRTQFGTRWTRPQSSTLTKNLQDRLNRFAANIKQATDS | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,613.338 | ||
Theoretical pI: | 5.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 43.469 | ||
aromaticity | 0.039 | ||
GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.202 | ||
sheet | 0.325 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143732.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
VNQNLERAVKENDRVYLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVE AVQISGGPSGLEAEIQQLRDLRRVNQELLVQTEELLQKEAGEDAQFRTQFGTRWTRPQSSTLTKNLQDRLNRFAANIKQATDS | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,613.338 | ||
Theoretical pI: | 5.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 43.469 | ||
aromaticity | 0.039 | ||
GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.202 | ||
sheet | 0.325 |