| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143745.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| RIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKL WFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,544.812 | ||
| Theoretical pI: | 6.927 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 39.050 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.173 | ||
| sheet | 0.302 | ||