Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143745.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
RIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKL WFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,544.812 | ||
Theoretical pI: | 6.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 39.050 | ||
aromaticity | 0.079 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.173 | ||
sheet | 0.302 |