Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143748.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
DLKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLA EGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,470.177 | ||
Theoretical pI: | 4.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 42.971 | ||
aromaticity | 0.077 | ||
GRAVY | -0.797 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.201 | ||
sheet | 0.337 |