| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143758.1 | internal | 192 | 2-577(+) |
Amino Acid sequence : | |||
| HEVIHISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCRQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTF ALTDDGTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAGDEHAVALDSSGYVYTWGRGYCGA | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,734.879 | ||
| Theoretical pI: | 6.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14940 | ||
| Instability index: | 21.946 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.154 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.255 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143758.1 | internal | 192 | 2-577(+) |
Amino Acid sequence : | |||
| HEVIHISASHNHASFVMQSGEVFTCGDNSSYCCGHGEVGRAIFRPTRIESLKGIPCRQVATGLSFTVFLTMQGHVYTCGNNTHGQLGHADTLDRPIPRKVEAFEGLGHVVQVAAGASYTF ALTDDGTVHSFGSCTNFCLGHGDQHDELLPRAIQSFQRRNIHVVRVSAGDEHAVALDSSGYVYTWGRGYCGA | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,734.879 | ||
| Theoretical pI: | 6.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14940 | ||
| Instability index: | 21.946 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.154 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.255 | ||
| sheet | 0.188 | ||