| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143763.1 | internal | 212 | 3-638(+) |
Amino Acid sequence : | |||
| SIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLI GPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAV | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 22,301.348 | ||
| Theoretical pI: | 7.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 31.798 | ||
| aromaticity | 0.052 | ||
| GRAVY | 0.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.259 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143763.1 | internal | 212 | 3-638(+) |
Amino Acid sequence : | |||
| SIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLI GPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAV | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 22,301.348 | ||
| Theoretical pI: | 7.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 31.798 | ||
| aromaticity | 0.052 | ||
| GRAVY | 0.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.259 | ||
| sheet | 0.236 | ||