Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143792.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
DLTPEHYQFFLYQLLRALKFIHTANVFHRDLKPKNILANADCKLKICDFGLARASFNDAPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLD LMTDLLGTPSA | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,906.123 | ||
Theoretical pI: | 7.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 24.592 | ||
aromaticity | 0.145 | ||
GRAVY | 0.079 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.191 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143792.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
DLTPEHYQFFLYQLLRALKFIHTANVFHRDLKPKNILANADCKLKICDFGLARASFNDAPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLD LMTDLLGTPSA | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,906.123 | ||
Theoretical pI: | 7.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 24.592 | ||
aromaticity | 0.145 | ||
GRAVY | 0.079 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.191 | ||
sheet | 0.260 |