Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143796.1 | 5prime_partial | 172 | 1-519(+) |
Amino Acid sequence : | |||
NSLESRIKIGMDFRVMGLDAPMLSALHHLMEDVSGSPEKEKATAPTRSYVRDATAMAATPLDIKELPNSYVFVVDMPGVKSGEIKVQVEDDGLLVITGERKREDGDKEDQHHKYLRMERR MGKFMRKFSLPENVDTENGISAVCQDGVLTVTVQKKPPPEPKKPKTIEVKVS* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 19,206.908 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 36.342 | ||
aromaticity | 0.041 | ||
GRAVY | -0.565 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.221 | ||
sheet | 0.262 |