Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143807.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
KLPLTAENVESVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIQSRLMEKIPEIVAVEPITDEETGLELNKENIEKVLDEIRPYLVGTGGGELEFVAIEEPIVK VRLSGPAAGVMTVRVALTQKLREKIPSIAAVQLL* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,632.263 | ||
Theoretical pI: | 4.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 48.279 | ||
aromaticity | 0.019 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.221 | ||
sheet | 0.344 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143807.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
KLPLTAENVESVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIQSRLMEKIPEIVAVEPITDEETGLELNKENIEKVLDEIRPYLVGTGGGELEFVAIEEPIVK VRLSGPAAGVMTVRVALTQKLREKIPSIAAVQLL* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,632.263 | ||
Theoretical pI: | 4.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 48.279 | ||
aromaticity | 0.019 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.221 | ||
sheet | 0.344 |