Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143811.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
HEVAMALAFRLLSRSKQFYVSQVILQQGHGVSVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERIIIDPEDPAAVRQYSNIMKMIREKAGLMTENEKVEYTVTHITKGIP DARTYLLKLKEIRIKSGIEDTIGGEAMMMEALDNIEKQIGKPLLRSDRKNVALLQAEWEKGNKKLGVPRYEEIPKQKDEWDLNAAREDLEWLKKDAIEAMETQ | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 11,539.804 | ||
Theoretical pI: | 9.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 36.922 | ||
aromaticity | 0.124 | ||
GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.314 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143811.1 | 5prime_partial | 122 | 670-302(-) |
Amino Acid sequence : | |||
LRLHCLYSILLKPLQVLSGSIQIPLIFLLGYLFITRNSKLFVALLPLCLKKGHILPVRPQKWLANLFLNVIQCFHHHSFTTYGILNATLDSYFLELQQVCSGIRDTFCYMCNSIFNFLIF CH* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 11,539.804 | ||
Theoretical pI: | 9.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 36.922 | ||
aromaticity | 0.124 | ||
GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.314 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143811.1 | complete | 105 | 465-148(-) |
Amino Acid sequence : | |||
MLSNASIIIASPPMVSSMPLLIRISLSFNKYVLASGIPFVICVTVYSTFSFSVIRPAFSLIIFMMLEYCLTAAGSSGSMMILSFRSIPRITSNFCFTSKKISFNI* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,539.804 | ||
Theoretical pI: | 9.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 36.922 | ||
aromaticity | 0.124 | ||
GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.314 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143811.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
HEVAMALAFRLLSRSKQFYVSQVILQQGHGVSVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERIIIDPEDPAAVRQYSNIMKMIREKAGLMTENEKVEYTVTHITKGIP DARTYLLKLKEIRIKSGIEDTIGGEAMMMEALDNIEKQIGKPLLRSDRKNVALLQAEWEKGNKKLGVPRYEEIPKQKDEWDLNAAREDLEWLKKDAIEAMETQ | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 11,539.804 | ||
Theoretical pI: | 9.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 36.922 | ||
aromaticity | 0.124 | ||
GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.314 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143811.1 | 5prime_partial | 122 | 670-302(-) |
Amino Acid sequence : | |||
LRLHCLYSILLKPLQVLSGSIQIPLIFLLGYLFITRNSKLFVALLPLCLKKGHILPVRPQKWLANLFLNVIQCFHHHSFTTYGILNATLDSYFLELQQVCSGIRDTFCYMCNSIFNFLIF CH* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 11,539.804 | ||
Theoretical pI: | 9.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 36.922 | ||
aromaticity | 0.124 | ||
GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.314 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143811.1 | complete | 105 | 465-148(-) |
Amino Acid sequence : | |||
MLSNASIIIASPPMVSSMPLLIRISLSFNKYVLASGIPFVICVTVYSTFSFSVIRPAFSLIIFMMLEYCLTAAGSSGSMMILSFRSIPRITSNFCFTSKKISFNI* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,539.804 | ||
Theoretical pI: | 9.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 36.922 | ||
aromaticity | 0.124 | ||
GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.314 | ||
sheet | 0.219 |