| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143811.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
| HEVAMALAFRLLSRSKQFYVSQVILQQGHGVSVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERIIIDPEDPAAVRQYSNIMKMIREKAGLMTENEKVEYTVTHITKGIP DARTYLLKLKEIRIKSGIEDTIGGEAMMMEALDNIEKQIGKPLLRSDRKNVALLQAEWEKGNKKLGVPRYEEIPKQKDEWDLNAAREDLEWLKKDAIEAMETQ | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 11,539.804 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 36.922 | ||
| aromaticity | 0.124 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.314 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143811.1 | 5prime_partial | 122 | 670-302(-) |
Amino Acid sequence : | |||
| LRLHCLYSILLKPLQVLSGSIQIPLIFLLGYLFITRNSKLFVALLPLCLKKGHILPVRPQKWLANLFLNVIQCFHHHSFTTYGILNATLDSYFLELQQVCSGIRDTFCYMCNSIFNFLIF CH* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 11,539.804 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 36.922 | ||
| aromaticity | 0.124 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.314 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143811.1 | complete | 105 | 465-148(-) |
Amino Acid sequence : | |||
| MLSNASIIIASPPMVSSMPLLIRISLSFNKYVLASGIPFVICVTVYSTFSFSVIRPAFSLIIFMMLEYCLTAAGSSGSMMILSFRSIPRITSNFCFTSKKISFNI* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,539.804 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 36.922 | ||
| aromaticity | 0.124 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.314 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143811.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
| HEVAMALAFRLLSRSKQFYVSQVILQQGHGVSVRSYAKEAAPPAPLKGDQMLKDIFFEVKQKFDVILGILRKERIIIDPEDPAAVRQYSNIMKMIREKAGLMTENEKVEYTVTHITKGIP DARTYLLKLKEIRIKSGIEDTIGGEAMMMEALDNIEKQIGKPLLRSDRKNVALLQAEWEKGNKKLGVPRYEEIPKQKDEWDLNAAREDLEWLKKDAIEAMETQ | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 11,539.804 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 36.922 | ||
| aromaticity | 0.124 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.314 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143811.1 | 5prime_partial | 122 | 670-302(-) |
Amino Acid sequence : | |||
| LRLHCLYSILLKPLQVLSGSIQIPLIFLLGYLFITRNSKLFVALLPLCLKKGHILPVRPQKWLANLFLNVIQCFHHHSFTTYGILNATLDSYFLELQQVCSGIRDTFCYMCNSIFNFLIF CH* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 11,539.804 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 36.922 | ||
| aromaticity | 0.124 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.314 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143811.1 | complete | 105 | 465-148(-) |
Amino Acid sequence : | |||
| MLSNASIIIASPPMVSSMPLLIRISLSFNKYVLASGIPFVICVTVYSTFSFSVIRPAFSLIIFMMLEYCLTAAGSSGSMMILSFRSIPRITSNFCFTSKKISFNI* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,539.804 | ||
| Theoretical pI: | 9.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 36.922 | ||
| aromaticity | 0.124 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.314 | ||
| sheet | 0.219 | ||