Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143889.1 | 5prime_partial | 172 | 1-519(+) |
Amino Acid sequence : | |||
EKEGFFFPKKMAPIAVGDSIPDGTLAWFDENDELKQVSIHSLASGKKVILFGVPGAFTPTCSMQHVPGFITSADELKSKGVDEILLVSVNDPFVMKAWAKTYPDNKHVKFLADGSGTYTR ALGLELDLSEKGLGTRSRRFALLADDLKVKVANIEEGGAFTISGADEILKAL* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,575.079 | ||
Theoretical pI: | 5.410 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 30.759 | ||
aromaticity | 0.087 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.233 | ||
sheet | 0.279 |