| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143925.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
| IVLSPSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,003.766 | ||
| Theoretical pI: | 9.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 30.711 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.176 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143925.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
| IVLSPSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,003.766 | ||
| Theoretical pI: | 9.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 30.711 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.176 | ||
| sheet | 0.229 | ||