Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143925.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
IVLSPSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,003.766 | ||
Theoretical pI: | 9.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 30.711 | ||
aromaticity | 0.041 | ||
GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.176 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143925.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
IVLSPSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,003.766 | ||
Theoretical pI: | 9.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 30.711 | ||
aromaticity | 0.041 | ||
GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.176 | ||
sheet | 0.229 |