Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143926.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
HEACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,262.535 | ||
Theoretical pI: | 4.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.893 | ||
aromaticity | 0.075 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.271 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143926.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
HEACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,262.535 | ||
Theoretical pI: | 4.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.893 | ||
aromaticity | 0.075 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.271 | ||
sheet | 0.280 |