| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143936.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
| ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIAND | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,129.508 | ||
| Theoretical pI: | 4.824 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 40.647 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.282 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143936.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
| ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIAND | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,129.508 | ||
| Theoretical pI: | 4.824 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 40.647 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.282 | ||
| sheet | 0.220 | ||