| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143945.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
| WRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSIIPQPQDNQQVVGPCLYTVQIHTSCLSPPKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGSVRYR * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,054.654 | ||
| Theoretical pI: | 9.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.917 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.274 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143945.1 | 5prime_partial | 117 | 594-241(-) |
Amino Acid sequence : | |||
| RAMITVTIIVSRIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHAAATVATVELPYRYSIGSPAVVPVSAQIQVANTISGTARTLNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,054.654 | ||
| Theoretical pI: | 9.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.917 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.274 | ||
| sheet | 0.214 | ||