| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143947.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| NPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVT VPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,993.200 | ||
| Theoretical pI: | 9.008 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 39.360 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.275 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143947.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| NPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVT VPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,993.200 | ||
| Theoretical pI: | 9.008 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 39.360 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.275 | ||
| sheet | 0.225 | ||