| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143960.1 | 5prime_partial | 113 | 2-343(+) |
Amino Acid sequence : | |||
| YYMGGTFHFTFQVSSSYPHEPPKVKCKTKIYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLNLLFMAPNDEDPLNHEAALVLRDNPKLFETNVRRAMAGGYIGQTYFTRCT* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,997.752 | ||
| Theoretical pI: | 7.069 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 53.343 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.248 | ||
| sheet | 0.221 | ||