Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143960.1 | 5prime_partial | 113 | 2-343(+) |
Amino Acid sequence : | |||
YYMGGTFHFTFQVSSSYPHEPPKVKCKTKIYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLNLLFMAPNDEDPLNHEAALVLRDNPKLFETNVRRAMAGGYIGQTYFTRCT* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,997.752 | ||
Theoretical pI: | 7.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 53.343 | ||
aromaticity | 0.124 | ||
GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.248 | ||
sheet | 0.221 |